UniProtKB/Swiss-Prot PTM Description

Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE)

N-glycosylated. Differential glycosylation produces a number of isoforms. N-linked glycan at Asn-107 is alternatively di-antennary, tri-antennary or tetra-antennary. The glycan at Asn-70 is di-antennary with trace amounts of tri-antennary. Glycan at Asn-271 is exclusively di-antennary. Structure of glycans at Asn-70 and Asn-271 is Hex5HexNAc4. The structure of the antennae is Neu5Ac(alpha1-6)Gal(beta1-4)GlcNAc attached to the core structure Man(alpha1-6)[Man(alpha1-3)]Man(beta1-4)GlcNAc(beta1-4)GlcNAc. Some antennae are fucosylated, which forms a Lewis-X determinant Proteolytic processing may yield the truncated form that ranges from Asp-30 to Lys-418 (Microbial infection) Proteolytically processed by Staphylococcus aureus seryl, cysteinyl, and metallo-proteases

Glycosylation Sites

Position Structures Description Evidence
ASN-70, ASN-107, ASN-271 Associated Structures: 4 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-70 Associated Structures: 0 Site specific GlycoSuite
ASN-107 Associated Structures: 0 Site specific GlycoSuite
ASN-271 Associated Structures: 0 Site specific GlycoSuite
Compositional data available: 3 compositions reported:

271 [Hex]5 [HexNAc]4 [Hex]5 [HexNAc]4 [NeuAc]2

70 [Hex]5 [HexNAc]4

Glycan Structures

Notes

Accompanying information

  1. ASN-70, ASN-107 & ASN-271 [MEGA ET AL. (1980) J. BIOL. CHEM. 255:4053-4056
  2. ASN-70
  3. ASN-107
  4. ASN-271

Structure Format

CFG/Essentials Text Oxford

Sequence

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK