UniCarbKB

UniProtKB/Swiss-Prot PTM Description

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons

Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161

Glycan Structures

Notes

Accompanying information

Structure Format

CFG/Essentials Text Oxford

Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Biological Associations

Taxonomy (1) Protein (1) Source

References 2

The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing

Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino

PubMed: 11469797 Year: 2001
Remodeling of sugar chain structures of human interferon-gamma.

Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T

PubMed: 10764830 Year: 2000

Associated Structures

Accession: P01579 UniProtKB/Swiss-Prot Entry