UniProtKB/Swiss-Prot PTM Description

Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity

Sulfated on 2 tyrosine residues N- and O-glycosylated Phosphorylation on Thr-69 and Thr-76 favors cell adhesion and spreading It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both Phosphorylation sites are present in the extracellular medium

Notes

Accompanying information

Structure Format

CFG/Essentials Text Oxford

Sequence

MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

References 2

  1. Structures of the N-linked oligosaccharides on human plasma vitronectin.

    Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I

    PubMed: 7541354 Year: 1995

  2. Structures of the N-linked oligosaccharides on porcine plasma vitronectin.

    Yoneda A, Ogawa H, Matsumoto I, Ishizuka I, Hase S, Seno N

    PubMed: 7506656 Year: 1993