UniProtKB/Swiss-Prot PTM Description

Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection

Glycosylation Sites

Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-279 Associated Structures: 1 Site specific GlycoSuite
ASN-66 Associated Structures: 1 Site specific GlycoSuite
ASN-300 Associated Structures: 1 Site specific GlycoSuite
ASN-287 Associated Structures: 1 Site specific GlycoSuite
ASN-40 Associated Structures: 1 Site specific GlycoSuite
ASN-136 Associated Structures: 1 Site specific GlycoSuite

Glycan Structures

Notes

Accompanying information

  1. ASN-287 in UniProt including signal peptide (Asn259 in publication)
  2. ASN-279 in UniProt including signal peptide (Asn251 in publication)
  3. ASN-66 in UniProt including signal peptide (Asn38 in publication)
  4. ASN-300 in UniProt including signal peptide (Asn272 in publication)
  5. ASN-40 in UniProt including signal peptide (Asn12 in publication)
  6. ASN-136 in UniProt including signal peptide (Asn108 in publication)

Structure Format

CFG/Essentials Text Oxford

Sequence

MVGRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLFCLLSKC

References 1

  1. Glycosylation analysis of IgLON family proteins in rat brain by liquid chromatography and multiple-stage mass spectrometry.

    Itoh S, Hachisuka A, Kawasaki N, Hashii N, Teshima R, Hayakawa T, Kawanishi T, Yamaguchi T.

    PubMed: 18729387 Year: 2008