UniProtKB/Swiss-Prot PTM Description

Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching

Glycosylation Sites

Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-184 Associated Structures: 4 Site specific GlycoSuite

Glycan Structures

Notes

Accompanying information

Structure Format

CFG/Essentials Text Oxford

Sequence

MGKSLSHLPLHSNKEDGYDGVTSTDNMRNGLVSSEVRNEDGRSGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDSQKRMIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLSNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLPSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ

References 1

  1. Site-specific glycan-peptide analysis for determination of N-glycoproteome heterogeneity

    Parker BL, Thaysen-Andersen M, Solis N, Scott NE, Larsen MR, Graham ME, Packer NH, Cordwell SJ.

    PubMed: 24090084 Year: 2013